PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.ZJ03A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 273aa    MW: 29880.2 Da    PI: 6.7141
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.ZJ03AgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.11.7e-27111161152
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                  +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQk
  Araip.ZJ03A 111 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQK 161
                  59*******************.*****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.54E-16108161IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-26110161IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-22112161IPR006447Myb domain, plants
PfamPF002492.0E-6114161IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MREEDSNWFA RWEDELPPPE ELMPLSQTLI TPDLAIAFDI PSPHTPTAAA TATPTTPNHH  60
LHHHQQPQQP QPPSNPSPSH QQQPSSGGDF ADSGDLGSGA AGEEPARTLK RPRLVWTPQL  120
HKRFVDAVAH LGIKNAVPKT IMQLMSVDGL TRENVASHLQ KPNSEHFLPF VSVPAMHHQQ  180
HHHQMAAAAA GAAAMQHVQL QQQFHRQASG HFGSPPNGHF EHAFMSRQQP PPQNQQQQFN  240
RMGGGVAGYA EDMESANASG ARKVLTLFPT GDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-17110161455ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016181526.11e-122PREDICTED: transcription factor PCL1
SwissprotQ9SNB43e-36PCL1_ARATH; Transcription factor LUX
TrEMBLV7CV762e-96V7CV76_PHAVU; Uncharacterized protein
STRINGPOPTR_0006s03340.14e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85423045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.13e-40G2-like family protein